PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00078.120
Common NameAMTR_s00078p00145410, LOC18431990
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family WRKY
Protein Properties Length: 206aa    MW: 23010.8 Da    PI: 7.2991
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00078.120genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.51.8e-30108166159
                                               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                               ldDgy+WrKYG+K+vk+s++pr+YYrC+  gCpvkkkver+a+d  +v++ Yeg+Hnh+
  evm_27.model.AmTr_v1.0_scaffold00078.120 108 LDDGYRWRKYGKKSVKNSPNPRNYYRCSNGGCPVKKKVERDAKDSAFVITSYEGRHNHT 166
                                               59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.3E-3296168IPR003657WRKY domain
SuperFamilySSF1182901.03E-26100168IPR003657WRKY domain
PROSITE profilePS5081131.376103168IPR003657WRKY domain
SMARTSM007742.2E-33108167IPR003657WRKY domain
PfamPF031064.3E-24109165IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MSNPFFRQPN MPEFFPESDD QFPFQLSDYL VLEEGSDDSS GLKSPEDLCP SNDMQFKTPA  60
CLPESGANSG QGVSDSSNSK LGTKKLKKMK VENGVRVAFR TQSDVEILDD GYRWRKYGKK  120
SVKNSPNPRN YYRCSNGGCP VKKKVERDAK DSAFVITSYE GRHNHTCPCV IYYTAPQPFL  180
DYASSPEMHL LMQSAVAFQG PYVIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A3e-2896168274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006842164.11e-153PREDICTED: probable WRKY transcription factor 50
TrEMBLW1P8431e-153W1P843_AMBTC; Uncharacterized protein
STRINGPOPTR_0007s06720.11e-44(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.12e-37WRKY DNA-binding protein 51
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]